Lineage for d1vhbb_ (1vhb B:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 43952Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 43953Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 43963Family a.1.1.2: Globins [46463] (17 proteins)
  6. 43967Protein Bacterial dimeric hemoglobin [46526] (1 species)
  7. 43968Species Vitreoscilla stercoraria [TaxId:61] [46527] (4 PDB entries)
  8. 43970Domain d1vhbb_: 1vhb B: [15628]

Details for d1vhbb_

PDB Entry: 1vhb (more details), 1.83 Å

PDB Description: bacterial dimeric hemoglobin from vitreoscilla stercoraria

SCOP Domain Sequences for d1vhbb_:

Sequence, based on SEQRES records: (download)

>d1vhbb_ a.1.1.2 (B:) Bacterial dimeric hemoglobin {Vitreoscilla stercoraria}
ldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfdmgrqesleqpkalamtv
laaaqnienlpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddilda
wgkaygviadvfiqveadlyaqav

Sequence, based on observed residues (ATOM records): (download)

>d1vhbb_ a.1.1.2 (B:) Bacterial dimeric hemoglobin {Vitreoscilla stercoraria}
ldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfqpkalamtvlaaaqnien
lpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddildawgkaygvia
dvfiqveadlyaqav

SCOP Domain Coordinates for d1vhbb_:

Click to download the PDB-style file with coordinates for d1vhbb_.
(The format of our PDB-style files is described here.)

Timeline for d1vhbb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vhba_