SCOPe 2.01: Domain d3cces1: 3cce S:1-81

Lineage for d3cces1 (3cce S:1-81)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
   beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243

4. Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families)

5. Family d.12.1.1: L23p [54190] (1 protein)

6. Protein Ribosomal protein L23 [54191] (4 species)

7. Species Haloarcula marismortui [TaxId:2238] [54192] (62 PDB entries)
   Uniprot P12732

8. Domain d3cces1: 3cce S:1-81 [156276]
   Other proteins in same PDB: d3cce11, d3cce21, d3cce31, d3cceb1, d3cced1, d3ccef1, d3cceh1, d3ccei1, d3ccej1, d3ccek1, d3ccel1, d3ccen1, d3cceo1, d3ccep1, d3cceq1, d3ccer1, d3ccet1, d3cceu1, d3ccev1, d3ccew1, d3ccex1, d3ccey1, d3ccez1
   automatically matched to d1jj2r_
   complexed with cd, cl, k, mg, na, sr; mutant

Details for d3cces1

PDB Entry: 3cce, 2.75 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535a

PDB Compounds: (S:) 50S ribosomal protein L23P

SCOPe Domain Sequences for d3cces1:

Sequence; same for both SEQRES and ATOM records:

>d3cces1 d.12.1.1 (S:1-81) Ribosomal protein L23 {Haloarcula marismortui [TaxId: 2238]}
swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg
ekkavvrlsedddaqevasri

Timeline for d3cces1:

• d3cces1 first appeared in SCOP 1.75
  
• d3cces1 appears in SCOPe 2.02
  
• d3cces1 appears in the current release, SCOPe 2.08