SCOPe 2.02: Domain d1vhba_: 1vhb A:

Lineage for d1vhba_ (1vhb A:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Bacterial dimeric hemoglobin [46526] (1 species)

7. Species Vitreoscilla stercoraria [TaxId:61] [46527] (4 PDB entries)

8. Domain d1vhba_: 1vhb A: [15627]
   complexed with hem

Details for d1vhba_

PDB Entry: 1vhb, 1.83 Å

PDB Description: bacterial dimeric hemoglobin from vitreoscilla stercoraria

PDB Compounds: (A:) hemoglobin

SCOPe Domain Sequences for d1vhba_:

Sequence, based on SEQRES records:

>d1vhba_ a.1.1.2 (A:) Bacterial dimeric hemoglobin {Vitreoscilla stercoraria [TaxId: 61]}
ldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfdmgrqesleqpkalamtv
laaaqnienlpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddilda
wgkaygviadvfiqveadlyaqav

Sequence, based on observed residues (ATOM records):

>d1vhba_ a.1.1.2 (A:) Bacterial dimeric hemoglobin {Vitreoscilla stercoraria [TaxId: 61]}
ldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfqpkalamtvlaaaqnien
lpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddildawgkaygvia
dvfiqveadlyaqav

Timeline for d1vhba_:

• d1vhba_ first appeared (with stable ids) in SCOP 1.55
  
• d1vhba_ appears in SCOPe 2.01
  
• d1vhba_ appears in SCOPe 2.03
  
• d1vhba_ appears in the current release, SCOPe 2.08