Lineage for d1vhba_ (1vhb A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 758333Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 758334Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 758373Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 758377Protein Bacterial dimeric hemoglobin [46526] (1 species)
  7. 758378Species Vitreoscilla stercoraria [TaxId:61] [46527] (4 PDB entries)
  8. 758379Domain d1vhba_: 1vhb A: [15627]

Details for d1vhba_

PDB Entry: 1vhb (more details), 1.83 Å

PDB Description: bacterial dimeric hemoglobin from vitreoscilla stercoraria
PDB Compounds: (A:) hemoglobin

SCOP Domain Sequences for d1vhba_:

Sequence, based on SEQRES records: (download)

>d1vhba_ a.1.1.2 (A:) Bacterial dimeric hemoglobin {Vitreoscilla stercoraria [TaxId: 61]}
ldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfdmgrqesleqpkalamtv
laaaqnienlpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddilda
wgkaygviadvfiqveadlyaqav

Sequence, based on observed residues (ATOM records): (download)

>d1vhba_ a.1.1.2 (A:) Bacterial dimeric hemoglobin {Vitreoscilla stercoraria [TaxId: 61]}
ldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfqpkalamtvlaaaqnien
lpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddildawgkaygvia
dvfiqveadlyaqav

SCOP Domain Coordinates for d1vhba_:

Click to download the PDB-style file with coordinates for d1vhba_.
(The format of our PDB-style files is described here.)

Timeline for d1vhba_: