Lineage for d3ccek1 (3cce K:1-132)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3042555Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 3042556Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 3043573Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 3043708Protein Prokaryotic (50S subunit) [58125] (3 species)
  7. 3043855Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 3043945Domain d3ccek1: 3cce K:1-132 [156269]
    Other proteins in same PDB: d3cce21, d3cceb1, d3ccef1, d3cceh1, d3ccei1, d3ccep1, d3ccer1, d3cces1, d3ccey1, d3ccez1
    automatically matched to d1w2bj_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccek1

PDB Entry: 3cce (more details), 2.75 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535a
PDB Compounds: (K:) 50S ribosomal protein L14P

SCOPe Domain Sequences for d3ccek1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ccek1 i.1.1.2 (K:1-132) Prokaryotic (50S subunit) {Haloarcula marismortui [TaxId: 2238]}
mealgadvtqglekgslitcadntgarelkvisvhgysgtknrhpkaglgdkitvsvtkg
tpemrrqvleavvvrqrkpirrpdgtrvkfednaavivdenedprgtelkgpiarevaqr
fgsvasaatmiv

SCOPe Domain Coordinates for d3ccek1:

Click to download the PDB-style file with coordinates for d3ccek1.
(The format of our PDB-style files is described here.)

Timeline for d3ccek1: