SCOPe 2.06: Domain d1hlba_: 1hlb A:

Lineage for d1hlba_ (1hlb A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, different isoforms [46524] (1 species)

7. Species Caudina arenicola, also known as Molpadia arenicola [TaxId:7698] [46525] (2 PDB entries)

8. Domain d1hlba_: 1hlb A: [15625]
   complexed with hem

Details for d1hlba_

PDB Entry: 1hlb, 2.5 Å

PDB Description: structural analysis of monomeric hemichrome and dimeric cyanomet hemoglobins from caudina arenicola

PDB Compounds: (A:) hemoglobin (deoxy)

SCOPe Domain Sequences for d1hlba_:

Sequence; same for both SEQRES and ATOM records:

>d1hlba_ a.1.1.2 (A:) Hemoglobin, different isoforms {Caudina arenicola, also known as Molpadia arenicola [TaxId: 7698]}
ggtlaiqaqgdltlaqkkivrktwhqlmrnktsfvtdvfirifaydpsaqnkfpqmagms
asqlrssrqmqahairvssimseyveeldsdilpellatlarthdlnkvgadhynlfakv
lmealqaelgsdfnektrdawakafsvvqavllvkhg

Timeline for d1hlba_:

• d1hlba_ first appeared (with stable ids) in SCOP 1.55, called d1hlb__
  
• d1hlba_ appears in SCOPe 2.05
  
• d1hlba_ appears in SCOPe 2.07
  
• d1hlba_ appears in the current release, SCOPe 2.08