SCOPe 2.06: Domain d1ithb_: 1ith B:

Lineage for d1ithb_ (1ith B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin [46522] (1 species)

7. Species Innkeeper worm (Urechis caupo) [TaxId:6431] [46523] (1 PDB entry)

8. Domain d1ithb_: 1ith B: [15624]
   complexed with cyn, hem

Details for d1ithb_

PDB Entry: 1ith, 2.5 Å

PDB Description: structure determination and refinement of homotetrameric hemoglobin from urechis caupo at 2.5 angstroms resolution

PDB Compounds: (B:) hemoglobin (cyano met)

SCOPe Domain Sequences for d1ithb_:

Sequence; same for both SEQRES and ATOM records:

>d1ithb_ a.1.1.2 (B:) Hemoglobin {Innkeeper worm (Urechis caupo) [TaxId: 6431]}
gltaaqikaiqdhwflnikgclqaaadsiffkyltaypgdlaffhkfssvplyglrsnpa
ykaqtltvinyldkvvdalggnagalmkakvpshdamgitpkhfgqllklvggvfqeefs
adpttvaawgdaagvlvaamk

Timeline for d1ithb_:

• d1ithb_ first appeared (with stable ids) in SCOP 1.55
  
• d1ithb_ appears in SCOPe 2.05
  
• d1ithb_ appears in SCOPe 2.07
  
• d1ithb_ appears in the current release, SCOPe 2.08