Lineage for d3cc7n1 (3cc7 N:1-186)

  1. Root: SCOPe 2.02
  2. 1248417Class i: Low resolution protein structures [58117] (25 folds)
  3. 1248418Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1248419Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1249271Family i.1.1.2: Large subunit [58124] (1 protein)
  6. 1249272Protein 50S subunit [58125] (6 species)
  7. 1249421Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 1249458Domain d3cc7n1: 3cc7 N:1-186 [156231]
    Other proteins in same PDB: d3cc721, d3cc7b1, d3cc7f1, d3cc7h1, d3cc7i1, d3cc7p1, d3cc7r1, d3cc7s1, d3cc7y1, d3cc7z1
    automatically matched to d1w2bm_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3cc7n1

PDB Entry: 3cc7 (more details), 2.7 Å

PDB Description: Structure of Anisomycin resistant 50S Ribosomal Subunit: 23S rRNA mutation C2487U
PDB Compounds: (N:) 50S ribosomal protein L18P

SCOPe Domain Sequences for d3cc7n1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cc7n1 i.1.1.2 (N:1-186) 50S subunit {Haloarcula marismortui [TaxId: 2238]}
atgprykvpmrrrreartdyhqrlrllksgkprlvarksnkhvraqlvtlgpngddtlas
ahssdlaeygweaptgnmpsayltgllaglraqeagveeavldiglnsptpgskvfaiqe
gaidagldiphnddvladwqrtrgahiaeydeqleeplysgdfdaadlpehfdelretll
dgdiel

SCOPe Domain Coordinates for d3cc7n1:

Click to download the PDB-style file with coordinates for d3cc7n1.
(The format of our PDB-style files is described here.)

Timeline for d3cc7n1: