Lineage for d3cc7i1 (3cc7 I:66-129)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1260481Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) (S)
  5. 1260482Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)
  6. 1260483Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)
  7. 1260531Species Haloarcula marismortui [TaxId:2238] [109705] (39 PDB entries)
    Uniprot P14122 67-136
  8. 1260547Domain d3cc7i1: 3cc7 I:66-129 [156227]
    Other proteins in same PDB: d3cc711, d3cc721, d3cc731, d3cc7b1, d3cc7d1, d3cc7f1, d3cc7h1, d3cc7j1, d3cc7k1, d3cc7l1, d3cc7n1, d3cc7o1, d3cc7p1, d3cc7q1, d3cc7r1, d3cc7s1, d3cc7t1, d3cc7u1, d3cc7v1, d3cc7w1, d3cc7x1, d3cc7y1, d3cc7z1
    automatically matched to d1s72i_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3cc7i1

PDB Entry: 3cc7 (more details), 2.7 Å

PDB Description: Structure of Anisomycin resistant 50S Ribosomal Subunit: 23S rRNA mutation C2487U
PDB Compounds: (I:) 50S ribosomal protein L11P

SCOPe Domain Sequences for d3cc7i1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cc7i1 a.4.7.1 (I:66-129) Ribosomal protein L11, C-terminal domain {Haloarcula marismortui [TaxId: 2238]}
gvpptaelikdeagfetgsgepqedfvadlsvdqvkqiaeqkhpdllsydltnaakevvg
tcts

SCOPe Domain Coordinates for d3cc7i1:

Click to download the PDB-style file with coordinates for d3cc7i1.
(The format of our PDB-style files is described here.)

Timeline for d3cc7i1: