SCOP 1.71: Domain d1ash__: 1ash -

Lineage for d1ash__ (1ash -)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Ascaris hemoglobin, domain 1 [46520] (1 species)

7. Species Pig roundworm (Ascaris suum) [TaxId:6253] [46521] (1 PDB entry)

8. Domain d1ash__: 1ash - [15622]
   complexed with hem, oxy

Details for d1ash__

PDB Entry: 1ash, 2.15 Å

PDB Description: the structure of ascaris hemoglobin domain i at 2.2 angstroms resolution: molecular features of oxygen avidity

SCOP Domain Sequences for d1ash__:

Sequence; same for both SEQRES and ATOM records:

>d1ash__ a.1.1.2 (-) Ascaris hemoglobin, domain 1 {Pig roundworm (Ascaris suum)}
anktrelcmkslehakvdtsnearqdgidlykhmfenypplrkyfksreeytaedvqndp
ffakqgqkillachvlcatyddretfnaytrelldrhardhvhmppevwtdfwklfeeyl
gkkttldeptkqawheigrefakeink

Timeline for d1ash__:

• d1ash__ first appeared (with stable ids) in SCOP 1.55
  
• d1ash__ appears in SCOP 1.69
  
• d1ash__ is called d1asha_ in SCOP 1.73
  
• d1ash__ appears in the current release, SCOPe 2.08, called d1asha_