Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily) beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243 |
Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) |
Family d.12.1.1: L23p [54190] (1 protein) automatically mapped to Pfam PF00276 |
Protein Ribosomal protein L23 [54191] (4 species) |
Species Haloarcula marismortui [TaxId:2238] [54192] (58 PDB entries) Uniprot P12732 |
Domain d3cc4s1: 3cc4 S:1-81 [156212] Other proteins in same PDB: d3cc411, d3cc421, d3cc431, d3cc4b1, d3cc4d1, d3cc4f1, d3cc4h1, d3cc4i1, d3cc4j1, d3cc4k1, d3cc4l1, d3cc4n1, d3cc4o1, d3cc4p1, d3cc4q1, d3cc4r1, d3cc4t1, d3cc4u1, d3cc4v1, d3cc4w1, d3cc4x1, d3cc4y1, d3cc4z1 automatically matched to d1jj2r_ complexed with anm, cd, cl, k, mg, na, sr |
PDB Entry: 3cc4 (more details), 2.7 Å
SCOPe Domain Sequences for d3cc4s1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cc4s1 d.12.1.1 (S:1-81) Ribosomal protein L23 {Haloarcula marismortui [TaxId: 2238]} swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg ekkavvrlsedddaqevasri
Timeline for d3cc4s1: