SCOPe 2.02: Domain d3cc4s1: 3cc4 S:1-81

Lineage for d3cc4s1 (3cc4 S:1-81)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
   beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243

4. Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families)

5. Family d.12.1.1: L23p [54190] (1 protein)

6. Protein Ribosomal protein L23 [54191] (4 species)

7. Species Haloarcula marismortui [TaxId:2238] [54192] (58 PDB entries)
   Uniprot P12732

8. Domain d3cc4s1: 3cc4 S:1-81 [156212]
   Other proteins in same PDB: d3cc411, d3cc421, d3cc431, d3cc4b1, d3cc4d1, d3cc4f1, d3cc4h1, d3cc4i1, d3cc4j1, d3cc4k1, d3cc4l1, d3cc4n1, d3cc4o1, d3cc4p1, d3cc4q1, d3cc4r1, d3cc4t1, d3cc4u1, d3cc4v1, d3cc4w1, d3cc4x1, d3cc4y1, d3cc4z1
   automatically matched to d1jj2r_
   complexed with anm, cd, cl, k, mg, na, sr

Details for d3cc4s1

PDB Entry: 3cc4, 2.7 Å

PDB Description: co-crystal structure of anisomycin bound to the 50s ribosomal subunit

PDB Compounds: (S:) 50S ribosomal protein L23P

SCOPe Domain Sequences for d3cc4s1:

Sequence; same for both SEQRES and ATOM records:

>d3cc4s1 d.12.1.1 (S:1-81) Ribosomal protein L23 {Haloarcula marismortui [TaxId: 2238]}
swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg
ekkavvrlsedddaqevasri

Timeline for d3cc4s1:

• d3cc4s1 first appeared in SCOP 1.75
  
• d3cc4s1 appears in SCOPe 2.01
  
• d3cc4s1 appears in SCOPe 2.03
  
• d3cc4s1 appears in the current release, SCOPe 2.08