Lineage for d3cc4r1 (3cc4 R:1-150)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192326Fold d.55: Ribosomal protein L22 [54842] (1 superfamily)
    beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation
  4. 2192327Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family) (S)
    some topological similarity to prokaryotic ribosomal protein L17
  5. 2192328Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein)
  6. 2192329Protein Ribosomal protein L22 [54845] (5 species)
  7. 2192367Species Haloarcula marismortui [TaxId:2238] [54847] (58 PDB entries)
    Uniprot P10970
  8. 2192414Domain d3cc4r1: 3cc4 R:1-150 [156211]
    Other proteins in same PDB: d3cc411, d3cc421, d3cc431, d3cc4b1, d3cc4d1, d3cc4f1, d3cc4h1, d3cc4i1, d3cc4j1, d3cc4k1, d3cc4l1, d3cc4n1, d3cc4o1, d3cc4p1, d3cc4q1, d3cc4s1, d3cc4t1, d3cc4u1, d3cc4v1, d3cc4w1, d3cc4x1, d3cc4y1, d3cc4z1
    automatically matched to d1ffko_
    complexed with anm, cd, cl, k, mg, na, sr

Details for d3cc4r1

PDB Entry: 3cc4 (more details), 2.7 Å

PDB Description: co-crystal structure of anisomycin bound to the 50s ribosomal subunit
PDB Compounds: (R:) 50S ribosomal protein L22P

SCOPe Domain Sequences for d3cc4r1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cc4r1 d.55.1.1 (R:1-150) Ribosomal protein L22 {Haloarcula marismortui [TaxId: 2238]}
gisysveadpdttakamlrerqmsfkhskaiareikgktageavdyleaviegdqpvpfk
qhnsgvghkskvdgwdagrypekaskafldllenavgnadhqgfdgeamtikhvaahkvg
eqqgrkpramgrasawnspqvdvelileep

SCOPe Domain Coordinates for d3cc4r1:

Click to download the PDB-style file with coordinates for d3cc4r1.
(The format of our PDB-style files is described here.)

Timeline for d3cc4r1: