SCOPe 2.08: Domain d1f5pe_: 1f5p E:

Lineage for d1f5pe_ (1f5p E:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Lamprey globin [46518] (2 species)

7. Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [46519] (4 PDB entries)

8. Domain d1f5pe_: 1f5p E: [15620]
   complexed with cmo, hem

Details for d1f5pe_

PDB Entry: 1f5p, 2.9 Å

PDB Description: 2.9 angstrom crystal structure of lamprey hemoglobin that has been exposed to carbon monoxide.

PDB Compounds: (E:) hemoglobin v

SCOPe Domain Sequences for d1f5pe_:

Sequence; same for both SEQRES and ATOM records:

>d1f5pe_ a.1.1.2 (E:) Lamprey globin {Sea lamprey (Petromyzon marinus) [TaxId: 7757]}
pivdtgsvaplsaaektkirsawapvystyetsgvdilvkfftstpaaqeffpkfkgltt
adqlkksadvrwhaeriinavndavasmddtekmsmklrdlsgkhaksfqvdpqyfkvla
aviadtvaagdagfeklmsmicillrsay

Timeline for d1f5pe_:

• d1f5pe_ first appeared (with stable ids) in SCOP 1.55
  
• d1f5pe_ appears in SCOPe 2.07