Lineage for d3cc4b1 (3cc4 B:1-337)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 952099Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 952119Superfamily b.43.3: Translation proteins [50447] (6 families) (S)
  5. 952274Family b.43.3.2: Ribosomal protein L3 [50461] (1 protein)
  6. 952275Protein Ribosomal protein L3 [50462] (4 species)
    superfamily fold is elaborated with additional structures
  7. 952316Species Haloarcula marismortui [TaxId:2238] [50463] (58 PDB entries)
    Uniprot P20279
  8. 952346Domain d3cc4b1: 3cc4 B:1-337 [156199]
    Other proteins in same PDB: d3cc411, d3cc421, d3cc431, d3cc4d1, d3cc4f1, d3cc4h1, d3cc4i1, d3cc4j1, d3cc4k1, d3cc4l1, d3cc4n1, d3cc4o1, d3cc4p1, d3cc4q1, d3cc4r1, d3cc4s1, d3cc4t1, d3cc4u1, d3cc4v1, d3cc4w1, d3cc4x1, d3cc4y1, d3cc4z1
    automatically matched to d1jj2b_
    complexed with anm, cd, cl, k, mg, na, sr

Details for d3cc4b1

PDB Entry: 3cc4 (more details), 2.7 Å

PDB Description: co-crystal structure of anisomycin bound to the 50s ribosomal subunit
PDB Compounds: (B:) 50S ribosomal protein L3P

SCOPe Domain Sequences for d3cc4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cc4b1 b.43.3.2 (B:1-337) Ribosomal protein L3 {Haloarcula marismortui [TaxId: 2238]}
pqpsrprkgslgfgprkrstsetprfnswpsddgqpgvqgfagykagmthvvlvndepns
pregmeetvpvtvietppmravalrayedtpygqrpltevwtdefhseldrtldvpedhd
pdaaeeqirdaheagdlgdlrlithtvpdavpsvpkkkpdvmetrvgggsvsdrldhald
ivedggehamndifrageyadvagvtkgkgtqgpvkrwgvqkrkgkharqgwrrrignlg
pwnpsrvrstvpqqgqtgyhqrtelnkrlidigegdeptvdggfvnygevdgpytlvkgs
vpgpdkrlvrfrpavrpndqprldpevryvsnesnqg

SCOPe Domain Coordinates for d3cc4b1:

Click to download the PDB-style file with coordinates for d3cc4b1.
(The format of our PDB-style files is described here.)

Timeline for d3cc4b1: