Lineage for d3cc411 (3cc4 1:1-56)

  1. Root: SCOPe 2.02
  2. 1248417Class i: Low resolution protein structures [58117] (25 folds)
  3. 1248418Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1248419Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1249271Family i.1.1.2: Large subunit [58124] (1 protein)
  6. 1249272Protein 50S subunit [58125] (6 species)
  7. 1249421Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 1249550Domain d3cc411: 3cc4 1:1-56 [156196]
    Other proteins in same PDB: d3cc421, d3cc4b1, d3cc4f1, d3cc4h1, d3cc4i1, d3cc4p1, d3cc4r1, d3cc4s1, d3cc4y1, d3cc4z1
    automatically matched to d1w2bz_
    complexed with anm, cd, cl, k, mg, na, sr

Details for d3cc411

PDB Entry: 3cc4 (more details), 2.7 Å

PDB Description: co-crystal structure of anisomycin bound to the 50s ribosomal subunit
PDB Compounds: (1:) 50S ribosomal protein L37e

SCOPe Domain Sequences for d3cc411:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cc411 i.1.1.2 (1:1-56) 50S subunit {Haloarcula marismortui [TaxId: 2238]}
tgagtpsqgkknttthtkcrrcgeksyhtkkkvcsscgfgksakrrdyewqskage

SCOPe Domain Coordinates for d3cc411:

Click to download the PDB-style file with coordinates for d3cc411.
(The format of our PDB-style files is described here.)

Timeline for d3cc411: