Lineage for d3cc2z1 (3cc2 Z:35-106)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1965821Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1966433Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 1966434Family g.41.8.1: Ribosomal protein L37ae [57830] (1 protein)
    automatically mapped to Pfam PF01780
  6. 1966435Protein Ribosomal protein L37ae [57831] (1 species)
  7. 1966436Species Haloarcula marismortui [TaxId:2238] [57832] (58 PDB entries)
    Uniprot P60619
  8. 1966470Domain d3cc2z1: 3cc2 Z:35-106 [156195]
    Other proteins in same PDB: d3cc211, d3cc221, d3cc231, d3cc2b1, d3cc2c1, d3cc2d1, d3cc2f1, d3cc2g1, d3cc2h1, d3cc2i1, d3cc2j1, d3cc2k1, d3cc2l1, d3cc2m1, d3cc2n1, d3cc2o1, d3cc2p1, d3cc2q1, d3cc2r1, d3cc2s1, d3cc2t1, d3cc2u1, d3cc2v1, d3cc2w1, d3cc2x1, d3cc2y1
    automatically matched to d1s72z_
    complexed with cd, cl, k, mg, na

Details for d3cc2z1

PDB Entry: 3cc2 (more details), 2.4 Å

PDB Description: The Refined Crystal Structure of the Haloarcula Marismortui Large Ribosomal Subunit at 2.4 Angstrom Resolution with rrnA Sequence for the 23S rRNA and Genome-derived Sequences for r-Proteins
PDB Compounds: (Z:) 50S ribosomal protein L37Ae

SCOPe Domain Sequences for d3cc2z1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cc2z1 g.41.8.1 (Z:35-106) Ribosomal protein L37ae {Haloarcula marismortui [TaxId: 2238]}
sgrfgarygrvsrrrvaeiesemnedhacpncgedrvdrqgtgiwqcsycdykftggsyk
petpggktvrrs

SCOPe Domain Coordinates for d3cc2z1:

Click to download the PDB-style file with coordinates for d3cc2z1.
(The format of our PDB-style files is described here.)

Timeline for d3cc2z1: