Lineage for d3cc2w1 (3cc2 W:1-154)

  1. Root: SCOPe 2.01
  2. 1069520Class i: Low resolution protein structures [58117] (25 folds)
  3. 1069521Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1069522Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1070374Family i.1.1.2: Large subunit [58124] (1 protein)
  6. 1070375Protein 50S subunit [58125] (6 species)
  7. 1070524Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 1070539Domain d3cc2w1: 3cc2 W:1-154 [156192]
    Other proteins in same PDB: d3cc221, d3cc2b1, d3cc2c1, d3cc2f1, d3cc2h1, d3cc2i1, d3cc2p1, d3cc2r1, d3cc2s1, d3cc2y1, d3cc2z1
    automatically matched to d1w2bv_
    complexed with cd, cl, k, mg, na

Details for d3cc2w1

PDB Entry: 3cc2 (more details), 2.4 Å

PDB Description: The Refined Crystal Structure of the Haloarcula Marismortui Large Ribosomal Subunit at 2.4 Angstrom Resolution with rrnA Sequence for the 23S rRNA and Genome-derived Sequences for r-Proteins
PDB Compounds: (W:) 50S ribosomal protein L30P

SCOPe Domain Sequences for d3cc2w1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cc2w1 i.1.1.2 (W:1-154) 50S subunit {Haloarcula marismortui [TaxId: 2238]}
mhalvqlrgevnmhtdiqdtlemlnihhvnhctlvpetdayrgmvakvndfvafgepsqe
tletvlatraeplegdadvddewvaehtdyddisglafallseettlreqglsptlrlhp
prgghdgvkhpvkeggqlgkhdtegiddlleamr

SCOPe Domain Coordinates for d3cc2w1:

Click to download the PDB-style file with coordinates for d3cc2w1.
(The format of our PDB-style files is described here.)

Timeline for d3cc2w1: