Lineage for d3cc2r1 (3cc2 R:1-150)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026181Fold d.55: Ribosomal protein L22 [54842] (1 superfamily)
    beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation
  4. 1026182Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family) (S)
    some topological similarity to prokaryotic ribosomal protein L17
  5. 1026183Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein)
  6. 1026184Protein Ribosomal protein L22 [54845] (5 species)
  7. 1026222Species Haloarcula marismortui [TaxId:2238] [54847] (58 PDB entries)
    Uniprot P10970
  8. 1026227Domain d3cc2r1: 3cc2 R:1-150 [156187]
    Other proteins in same PDB: d3cc211, d3cc221, d3cc231, d3cc2b1, d3cc2c1, d3cc2d1, d3cc2f1, d3cc2g1, d3cc2h1, d3cc2i1, d3cc2j1, d3cc2k1, d3cc2l1, d3cc2m1, d3cc2n1, d3cc2o1, d3cc2p1, d3cc2q1, d3cc2s1, d3cc2t1, d3cc2u1, d3cc2v1, d3cc2w1, d3cc2x1, d3cc2y1, d3cc2z1
    automatically matched to d1ffko_
    complexed with cd, cl, k, mg, na

Details for d3cc2r1

PDB Entry: 3cc2 (more details), 2.4 Å

PDB Description: The Refined Crystal Structure of the Haloarcula Marismortui Large Ribosomal Subunit at 2.4 Angstrom Resolution with rrnA Sequence for the 23S rRNA and Genome-derived Sequences for r-Proteins
PDB Compounds: (R:) 50S ribosomal protein L22P

SCOPe Domain Sequences for d3cc2r1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cc2r1 d.55.1.1 (R:1-150) Ribosomal protein L22 {Haloarcula marismortui [TaxId: 2238]}
gisysveadpdttakamlrerqmsfkhskaiareikgktageavdyleaviegdqpvpfk
qhnsgvghkskvdgwdagrypekaskafldllenavgnadhqgfdgeamtikhvaahkvg
eqqgrkpramgrasawnspqvdvelileep

SCOPe Domain Coordinates for d3cc2r1:

Click to download the PDB-style file with coordinates for d3cc2r1.
(The format of our PDB-style files is described here.)

Timeline for d3cc2r1: