Lineage for d1f5pc_ (1f5p C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2301243Protein Lamprey globin [46518] (2 species)
  7. 2301257Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [46519] (4 PDB entries)
  8. 2301279Domain d1f5pc_: 1f5p C: [15618]
    complexed with cmo, hem

Details for d1f5pc_

PDB Entry: 1f5p (more details), 2.9 Å

PDB Description: 2.9 angstrom crystal structure of lamprey hemoglobin that has been exposed to carbon monoxide.
PDB Compounds: (C:) hemoglobin v

SCOPe Domain Sequences for d1f5pc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f5pc_ a.1.1.2 (C:) Lamprey globin {Sea lamprey (Petromyzon marinus) [TaxId: 7757]}
pivdtgsvaplsaaektkirsawapvystyetsgvdilvkfftstpaaqeffpkfkgltt
adqlkksadvrwhaeriinavndavasmddtekmsmklrdlsgkhaksfqvdpqyfkvla
aviadtvaagdagfeklmsmicillrsay

SCOPe Domain Coordinates for d1f5pc_:

Click to download the PDB-style file with coordinates for d1f5pc_.
(The format of our PDB-style files is described here.)

Timeline for d1f5pc_: