Lineage for d3cc2f1 (3cc2 F:1-119)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1914038Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1914576Superfamily d.79.3: L30e-like [55315] (4 families) (S)
  5. 1914577Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins)
  6. 1914594Protein Ribosomal protein L7ae [55319] (7 species)
  7. 1914602Species Haloarcula marismortui [TaxId:2238] [55320] (58 PDB entries)
    Uniprot P12743
  8. 1914636Domain d3cc2f1: 3cc2 F:1-119 [156175]
    Other proteins in same PDB: d3cc211, d3cc221, d3cc231, d3cc2b1, d3cc2c1, d3cc2d1, d3cc2g1, d3cc2h1, d3cc2i1, d3cc2j1, d3cc2k1, d3cc2l1, d3cc2m1, d3cc2n1, d3cc2o1, d3cc2p1, d3cc2q1, d3cc2r1, d3cc2s1, d3cc2t1, d3cc2u1, d3cc2v1, d3cc2w1, d3cc2x1, d3cc2y1, d3cc2z1
    automatically matched to d1s72f_
    complexed with cd, cl, k, mg, na

Details for d3cc2f1

PDB Entry: 3cc2 (more details), 2.4 Å

PDB Description: The Refined Crystal Structure of the Haloarcula Marismortui Large Ribosomal Subunit at 2.4 Angstrom Resolution with rrnA Sequence for the 23S rRNA and Genome-derived Sequences for r-Proteins
PDB Compounds: (F:) 50S ribosomal protein L7Ae

SCOPe Domain Sequences for d3cc2f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cc2f1 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Haloarcula marismortui [TaxId: 2238]}
pvyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeiv
mhipeladekgvpfifveqqddlghaaglevgsaaaavtdageadadvediadkveelr

SCOPe Domain Coordinates for d3cc2f1:

Click to download the PDB-style file with coordinates for d3cc2f1.
(The format of our PDB-style files is described here.)

Timeline for d3cc2f1: