Lineage for d3cc2c1 (3cc2 C:1-246)

  1. Root: SCOPe 2.01
  2. 1069520Class i: Low resolution protein structures [58117] (25 folds)
  3. 1069521Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1069522Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1069523Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 1069524Protein 70S ribosome functional complex [58121] (9 species)
  7. 1070147Species Haloarcula marismortui [TaxId:2238] [161279] (1 PDB entry)
  8. 1070148Domain d3cc2c1: 3cc2 C:1-246 [156173]
    Other proteins in same PDB: d3cc211, d3cc221, d3cc231, d3cc2b1, d3cc2d1, d3cc2f1, d3cc2g1, d3cc2h1, d3cc2i1, d3cc2j1, d3cc2k1, d3cc2l1, d3cc2m1, d3cc2n1, d3cc2o1, d3cc2p1, d3cc2q1, d3cc2r1, d3cc2s1, d3cc2t1, d3cc2u1, d3cc2v1, d3cc2w1, d3cc2x1, d3cc2y1, d3cc2z1
    automatically matched to d1giyf_
    complexed with cd, cl, k, mg, na

Details for d3cc2c1

PDB Entry: 3cc2 (more details), 2.4 Å

PDB Description: The Refined Crystal Structure of the Haloarcula Marismortui Large Ribosomal Subunit at 2.4 Angstrom Resolution with rrnA Sequence for the 23S rRNA and Genome-derived Sequences for r-Proteins
PDB Compounds: (C:) 50S ribosomal protein L4P

SCOPe Domain Sequences for d3cc2c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cc2c1 i.1.1.1 (C:1-246) 70S ribosome functional complex {Haloarcula marismortui [TaxId: 2238]}
mqatiydldgntdgevdlpdvfetpvrsdligkavraaqanrkqdygsdeyaglrtpaes
fgsgrgqahvpkqdgrarrvpqavkgrsahppktekdrsldlndkerqlavrsalaatad
adlvadrghefdrdevpvvvsddfedlvktqevvsllealdvhadidradetkikagqgs
argrkyrrpasilfvtsdepstaarnlagadvatasevntedlapggapgrltvftesal
aevaer

SCOPe Domain Coordinates for d3cc2c1:

Click to download the PDB-style file with coordinates for d3cc2c1.
(The format of our PDB-style files is described here.)

Timeline for d3cc2c1: