Lineage for d3cbib_ (3cbi B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2732921Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2733305Protein automated matches [190139] (27 species)
    not a true protein
  7. 2733387Species Daboia russellii [TaxId:97228] [186865] (27 PDB entries)
  8. 2733412Domain d3cbib_: 3cbi B: [156156]
    automated match to d1tjka_
    protein/RNA complex; complexed with ajm, ann

Details for d3cbib_

PDB Entry: 3cbi (more details), 3.15 Å

PDB Description: Crystal structure of the ternary complex of phospholipase A2 with ajmaline and anisic acid at 3.1 A resolution
PDB Compounds: (B:) Phospholipase A2 VRV-PL-VIIIa

SCOPe Domain Sequences for d3cbib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cbib_ a.133.1.2 (B:) automated matches {Daboia russellii [TaxId: 97228]}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

SCOPe Domain Coordinates for d3cbib_:

Click to download the PDB-style file with coordinates for d3cbib_.
(The format of our PDB-style files is described here.)

Timeline for d3cbib_: