Class a: All alpha proteins [46456] (258 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (4 families) |
Family a.1.1.2: Globins [46463] (26 proteins) Heme-binding protein |
Protein Lamprey globin [46518] (2 species) |
Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [46519] (4 PDB entries) |
Domain d3lhbl_: 3lhb L: [15615] complexed with hem |
PDB Entry: 3lhb (more details), 2.7 Å
SCOP Domain Sequences for d3lhbl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lhbl_ a.1.1.2 (L:) Lamprey globin {Sea lamprey (Petromyzon marinus) [TaxId: 7757]} pivdtgsvaplsaaektkirsawapvystyetsgvdilvkfftstpaaqeffpkfkgltt adelkksadvrwhaeriinavddavasmddtekmsmklrnlsgkhaksfqvdpeyfkvla aviadtvaagdagfeklmsmicillrsay
Timeline for d3lhbl_: