Lineage for d3lhbl_ (3lhb L:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 349260Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 349261Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 349289Family a.1.1.2: Globins [46463] (20 proteins)
    Heme-binding protein
  6. 350020Protein Lamprey globin [46518] (2 species)
  7. 350034Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [46519] (4 PDB entries)
  8. 350053Domain d3lhbl_: 3lhb L: [15615]
    complexed with hem

Details for d3lhbl_

PDB Entry: 3lhb (more details), 2.7 Å

PDB Description: the 2.7 angstrom crystal structure of deoxygenated hemoglobin from the sea lamprey (petromyzon marinus)

SCOP Domain Sequences for d3lhbl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lhbl_ a.1.1.2 (L:) Lamprey globin {Sea lamprey (Petromyzon marinus)}
pivdtgsvaplsaaektkirsawapvystyetsgvdilvkfftstpaaqeffpkfkgltt
adelkksadvrwhaeriinavddavasmddtekmsmklrnlsgkhaksfqvdpeyfkvla
aviadtvaagdagfeklmsmicillrsay

SCOP Domain Coordinates for d3lhbl_:

Click to download the PDB-style file with coordinates for d3lhbl_.
(The format of our PDB-style files is described here.)

Timeline for d3lhbl_: