Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein Proteasome beta subunit (catalytic) [56252] (5 species) |
Species Thermoplasma acidophilum [TaxId:2303] [56253] (5 PDB entries) |
Domain d3c92m1: 3c92 M:1-203 [156106] Other proteins in same PDB: d3c92a1, d3c92b1, d3c92c1, d3c92d1, d3c92e1, d3c92f1, d3c92g1, d3c92o1, d3c92p1, d3c92q1, d3c92r1, d3c92s1, d3c92t1, d3c92u1 automatically matched to d1pma1_ |
PDB Entry: 3c92 (more details), 6.8 Å
SCOPe Domain Sequences for d3c92m1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c92m1 d.153.1.4 (M:1-203) Proteasome beta subunit (catalytic) {Thermoplasma acidophilum [TaxId: 2303]} tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr kdgyvqlptdqiesrirklglil
Timeline for d3c92m1:
View in 3D Domains from other chains: (mouse over for more information) d3c9211, d3c9221, d3c92a1, d3c92b1, d3c92c1, d3c92d1, d3c92e1, d3c92f1, d3c92g1, d3c92h1, d3c92i1, d3c92j1, d3c92k1, d3c92l1, d3c92n1, d3c92o1, d3c92p1, d3c92q1, d3c92r1, d3c92s1, d3c92t1, d3c92u1, d3c92v1, d3c92w1, d3c92x1, d3c92y1, d3c92z1 |