Lineage for d3c92l1 (3c92 L:1-203)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 875596Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 875597Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (7 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 875747Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 876137Protein Proteasome beta subunit (catalytic) [56252] (5 species)
  7. 876146Species Archaeon Thermoplasma acidophilum [TaxId:2303] [56253] (6 PDB entries)
  8. 876202Domain d3c92l1: 3c92 L:1-203 [156105]
    Other proteins in same PDB: d3c92a1, d3c92b1, d3c92c1, d3c92d1, d3c92e1, d3c92f1, d3c92g1, d3c92o1, d3c92p1, d3c92q1, d3c92r1, d3c92s1, d3c92t1, d3c92u1
    automatically matched to d1pma1_

Details for d3c92l1

PDB Entry: 3c92 (more details), 6.8 Å

PDB Description: thermoplasma acidophilum 20s proteasome with a closed gate
PDB Compounds: (L:) Proteasome subunit beta

SCOP Domain Sequences for d3c92l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c92l1 d.153.1.4 (L:1-203) Proteasome beta subunit (catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]}
tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
kdgyvqlptdqiesrirklglil

SCOP Domain Coordinates for d3c92l1:

Click to download the PDB-style file with coordinates for d3c92l1.
(The format of our PDB-style files is described here.)

Timeline for d3c92l1: