Lineage for d3lhbg_ (3lhb G:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2687786Protein Lamprey globin [46518] (2 species)
  7. 2687800Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [46519] (4 PDB entries)
  8. 2687807Domain d3lhbg_: 3lhb G: [15610]
    complexed with hem

Details for d3lhbg_

PDB Entry: 3lhb (more details), 2.7 Å

PDB Description: the 2.7 angstrom crystal structure of deoxygenated hemoglobin from the sea lamprey (petromyzon marinus)
PDB Compounds: (G:) protein (hemoglobin)

SCOPe Domain Sequences for d3lhbg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lhbg_ a.1.1.2 (G:) Lamprey globin {Sea lamprey (Petromyzon marinus) [TaxId: 7757]}
pivdtgsvaplsaaektkirsawapvystyetsgvdilvkfftstpaaqeffpkfkgltt
adelkksadvrwhaeriinavddavasmddtekmsmklrnlsgkhaksfqvdpeyfkvla
aviadtvaagdagfeklmsmicillrsay

SCOPe Domain Coordinates for d3lhbg_:

Click to download the PDB-style file with coordinates for d3lhbg_.
(The format of our PDB-style files is described here.)

Timeline for d3lhbg_: