Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (7 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (3 proteins) |
Protein Proteasome alpha subunit (non-catalytic) [56255] (5 species) contains an extension to the common fold at the N-terminus |
Species Archaeon Thermoplasma acidophilum [TaxId:2303] [56256] (6 PDB entries) |
Domain d3c91g1: 3c91 G:13-233 [156072] Other proteins in same PDB: d3c9111, d3c9121, d3c91h1, d3c91i1, d3c91j1, d3c91k1, d3c91l1, d3c91m1, d3c91n1, d3c91v1, d3c91w1, d3c91x1, d3c91y1, d3c91z1 automatically matched to d1pmaa_ |
PDB Entry: 3c91 (more details), 6.8 Å
SCOP Domain Sequences for d3c91g1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c91g1 d.153.1.4 (G:13-233) Proteasome alpha subunit (non-catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} tvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlidd yvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrpy gvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavtl gikalkssleegeelkapeiasitvgnkyriydqeevkkfl
Timeline for d3c91g1:
View in 3D Domains from other chains: (mouse over for more information) d3c9111, d3c9121, d3c91a1, d3c91b1, d3c91c1, d3c91d1, d3c91e1, d3c91f1, d3c91h1, d3c91i1, d3c91j1, d3c91k1, d3c91l1, d3c91m1, d3c91n1, d3c91o1, d3c91p1, d3c91q1, d3c91r1, d3c91s1, d3c91t1, d3c91u1, d3c91v1, d3c91w1, d3c91x1, d3c91y1, d3c91z1 |