Lineage for d3c91g1 (3c91 G:13-233)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 875596Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 875597Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (7 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 875747Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 875859Protein Proteasome alpha subunit (non-catalytic) [56255] (5 species)
    contains an extension to the common fold at the N-terminus
  7. 875875Species Archaeon Thermoplasma acidophilum [TaxId:2303] [56256] (6 PDB entries)
  8. 875917Domain d3c91g1: 3c91 G:13-233 [156072]
    Other proteins in same PDB: d3c9111, d3c9121, d3c91h1, d3c91i1, d3c91j1, d3c91k1, d3c91l1, d3c91m1, d3c91n1, d3c91v1, d3c91w1, d3c91x1, d3c91y1, d3c91z1
    automatically matched to d1pmaa_

Details for d3c91g1

PDB Entry: 3c91 (more details), 6.8 Å

PDB Description: thermoplasma acidophilum 20s proteasome with an open gate
PDB Compounds: (G:) Proteasome subunit alpha

SCOP Domain Sequences for d3c91g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c91g1 d.153.1.4 (G:13-233) Proteasome alpha subunit (non-catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]}
tvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlidd
yvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrpy
gvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavtl
gikalkssleegeelkapeiasitvgnkyriydqeevkkfl

SCOP Domain Coordinates for d3c91g1:

Click to download the PDB-style file with coordinates for d3c91g1.
(The format of our PDB-style files is described here.)

Timeline for d3c91g1: