Lineage for d3c8kd_ (3c8k D:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2234637Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2234638Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2234639Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 2235083Protein automated matches [190329] (9 species)
    not a true protein
  7. 2235160Species Mouse (Mus musculus) [TaxId:10090] [187300] (3 PDB entries)
  8. 2235163Domain d3c8kd_: 3c8k D: [156052]
    Other proteins in same PDB: d3c8ka1, d3c8ka2, d3c8kb_
    automated match to d1p4ld_

Details for d3c8kd_

PDB Entry: 3c8k (more details), 2.9 Å

PDB Description: the crystal structure of ly49c bound to h-2kb
PDB Compounds: (D:) Natural killer cell receptor Ly-49C

SCOPe Domain Sequences for d3c8kd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c8kd_ d.169.1.1 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rgvkywfcystkcyyfimnkttwsgckancqhygvpilkiededelkflqrhvipgnywi
glsydkkkkewawidngpskldmkikkmnfksrgcvflskariedidcnipyycicgkkl
dkfpd

SCOPe Domain Coordinates for d3c8kd_:

Click to download the PDB-style file with coordinates for d3c8kd_.
(The format of our PDB-style files is described here.)

Timeline for d3c8kd_: