Lineage for d3c8kd1 (3c8k D:138-259)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 878002Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 878003Superfamily d.169.1: C-type lectin-like [56436] (8 families) (S)
  5. 878004Family d.169.1.1: C-type lectin domain [56437] (28 proteins)
    Pfam PF00059
  6. 878217Protein NK cell receptor [56452] (3 species)
  7. 878221Species Mouse (Mus musculus), ly49-c [TaxId:10090] [103351] (4 PDB entries)
  8. 878226Domain d3c8kd1: 3c8k D:138-259 [156052]
    Other proteins in same PDB: d3c8ka1, d3c8ka2, d3c8kb1
    automatically matched to d1p4ld_
    mutant

Details for d3c8kd1

PDB Entry: 3c8k (more details), 2.9 Å

PDB Description: The crystal structure of Ly49C bound to H-2Kb
PDB Compounds: (D:) Natural killer cell receptor Ly-49C

SCOP Domain Sequences for d3c8kd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c8kd1 d.169.1.1 (D:138-259) NK cell receptor {Mouse (Mus musculus), ly49-c [TaxId: 10090]}
rgvkywfcystkcyyfimnkttwsgckancqhygvpilkiededelkflqrhvipgnywi
glsydkkkkewawidngpskldmkikkmnfksrgcvflskariedidcnipyycicgkkl
dk

SCOP Domain Coordinates for d3c8kd1:

Click to download the PDB-style file with coordinates for d3c8kd1.
(The format of our PDB-style files is described here.)

Timeline for d3c8kd1: