SCOP 1.55: Domain d3lhbb_: 3lhb B:

Lineage for d3lhbb_ (3lhb B:)

1. Root: SCOP 1.55

2. Class a: All alpha proteins [46456] (138 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)

4. Superfamily a.1.1: Globin-like [46458] (3 families)

5. Family a.1.1.2: Globins [46463] (16 proteins)

6. Protein Lamprey globin [46518] (1 species)

7. Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [46519] (4 PDB entries)

8. Domain d3lhbb_: 3lhb B: [15605]

Details for d3lhbb_

PDB Entry: 3lhb, 2.7 Å

PDB Description: the 2.7 angstrom crystal structure of deoxygenated hemoglobin from the sea lamprey (petromyzon marinus)

SCOP Domain Sequences for d3lhbb_:

Sequence; same for both SEQRES and ATOM records:

>d3lhbb_ a.1.1.2 (B:) Lamprey globin {Sea lamprey (Petromyzon marinus)}
pivdtgsvaplsaaektkirsawapvystyetsgvdilvkfftstpaaqeffpkfkgltt
adelkksadvrwhaeriinavddavasmddtekmsmklrnlsgkhaksfqvdpeyfkvla
aviadtvaagdagfeklmsmicillrsay

Timeline for d3lhbb_:

• d3lhbb_ appears in SCOP 1.57
  
• d3lhbb_ appears in the current release, SCOPe 2.08