Lineage for d3c8jd_ (3c8j D:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1682071Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1682072Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1682776Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 1682777Protein automated matches [190159] (12 species)
    not a true protein
  7. 1683023Species Mouse (Mus musculus) [TaxId:10090] [187331] (17 PDB entries)
  8. 1683055Domain d3c8jd_: 3c8j D: [156048]
    automated match to d1qo3c_

Details for d3c8jd_

PDB Entry: 3c8j (more details), 2.6 Å

PDB Description: the crystal structure of natural killer cell receptor ly49c
PDB Compounds: (D:) Natural killer cell receptor Ly49C

SCOPe Domain Sequences for d3c8jd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c8jd_ d.169.1.0 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
srdtgrgvkywfcystkcyyfimnkttwsgckancqhygvpilkiededelkflqrhvip
gnywiglsydkkkkewawidngpskldmkikkmnfksrgcvflskariedidcnipyyci
cgkkldkfpd

SCOPe Domain Coordinates for d3c8jd_:

Click to download the PDB-style file with coordinates for d3c8jd_.
(The format of our PDB-style files is described here.)

Timeline for d3c8jd_: