Lineage for d1f5of_ (1f5o F:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 436026Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 436027Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 436063Family a.1.1.2: Globins [46463] (22 proteins)
    Heme-binding protein
  6. 436822Protein Lamprey globin [46518] (2 species)
  7. 436836Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [46519] (4 PDB entries)
  8. 436843Domain d1f5of_: 1f5o F: [15603]

Details for d1f5of_

PDB Entry: 1f5o (more details), 2.9 Å

PDB Description: 2.9 angstrom crystal structure of deoxygenated lamprey hemoglobin v in the space group p2(1)2(1)2(1)

SCOP Domain Sequences for d1f5of_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f5of_ a.1.1.2 (F:) Lamprey globin {Sea lamprey (Petromyzon marinus)}
pivdtgsvaplsaaektkirsawapvystyetsgvdilvkfftstpaaqeffpkfkgltt
adqlkksadvrwhaeriinavndavasmddtekmsmklrdlsgkhaksfqvdpqyfkvla
aviadtvaagdagfeklmsmicillrsay

SCOP Domain Coordinates for d1f5of_:

Click to download the PDB-style file with coordinates for d1f5of_.
(The format of our PDB-style files is described here.)

Timeline for d1f5of_: