Lineage for d3c7nb1 (3c7n B:390-543)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2824537Fold b.130: Heat shock protein 70kD (HSP70), peptide-binding domain [100919] (1 superfamily)
    beta-sandwich: 8 strands in 2 sheets
  4. 2824538Superfamily b.130.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100920] (1 family) (S)
  5. 2824539Family b.130.1.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100921] (3 proteins)
  6. 2824543Protein DnaK [100922] (3 species)
  7. 2824544Species Cow (Bos taurus) [TaxId:9913] [158953] (2 PDB entries)
  8. 2824546Domain d3c7nb1: 3c7n B:390-543 [156014]
    Other proteins in same PDB: d3c7nb2, d3c7nb3
    automatically matched to d1ckra_
    complexed with adp, bef, cl, mg, so4

Details for d3c7nb1

PDB Entry: 3c7n (more details), 3.12 Å

PDB Description: structure of the hsp110:hsc70 nucleotide exchange complex
PDB Compounds: (B:) Heat shock cognate

SCOPe Domain Sequences for d3c7nb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c7nb1 b.130.1.1 (B:390-543) DnaK {Cow (Bos taurus) [TaxId: 9913]}
dlllldvtplslgietaggvmtvlikrnttiptkqtqtfttysdnqpgvliqvyegeram
tkdnnllgkfeltgippaprgvpqievtfdidangilnvsavdkstgkenkititndkgr
lskediermvqeaekykaedekqrdkvssknsle

SCOPe Domain Coordinates for d3c7nb1:

Click to download the PDB-style file with coordinates for d3c7nb1.
(The format of our PDB-style files is described here.)

Timeline for d3c7nb1: