Lineage for d1f5od_ (1f5o D:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 93449Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 93450Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 93460Family a.1.1.2: Globins [46463] (18 proteins)
  6. 93995Protein Lamprey globin [46518] (1 species)
  7. 93996Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [46519] (4 PDB entries)
  8. 94001Domain d1f5od_: 1f5o D: [15601]

Details for d1f5od_

PDB Entry: 1f5o (more details), 2.9 Å

PDB Description: 2.9 angstrom crystal structure of deoxygenated lamprey hemoglobin v in the space group p2(1)2(1)2(1)

SCOP Domain Sequences for d1f5od_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f5od_ a.1.1.2 (D:) Lamprey globin {Sea lamprey (Petromyzon marinus)}
pivdtgsvaplsaaektkirsawapvystyetsgvdilvkfftstpaaqeffpkfkgltt
adqlkksadvrwhaeriinavndavasmddtekmsmklrdlsgkhaksfqvdpqyfkvla
aviadtvaagdagfeklmsmicillrsay

SCOP Domain Coordinates for d1f5od_:

Click to download the PDB-style file with coordinates for d1f5od_.
(The format of our PDB-style files is described here.)

Timeline for d1f5od_: