Lineage for d3c7ba1 (3c7b A:239-304)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 861004Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families) (S)
  5. 861105Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (13 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 861142Protein DsrA insert domain [160280] (2 species)
  7. 861143Species Archaeoglobus fulgidus [TaxId:2234] [160282] (1 PDB entry)
    Uniprot Q59109 240-305
  8. 861144Domain d3c7ba1: 3c7b A:239-304 [156001]
    Other proteins in same PDB: d3c7ba2, d3c7ba3, d3c7bb1, d3c7bb2, d3c7bb3, d3c7bd2, d3c7bd3, d3c7be1, d3c7be2, d3c7be3
    complexed with sf4, so3, srm

Details for d3c7ba1

PDB Entry: 3c7b (more details), 2 Å

PDB Description: Structure of the dissimilatory sulfite reductase from Archaeoglobus fulgidus
PDB Compounds: (A:) sulfite reductase, dissimilatory-type subunit alpha

SCOP Domain Sequences for d3c7ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c7ba1 d.58.1.5 (A:239-304) DsrA insert domain {Archaeoglobus fulgidus [TaxId: 2234]}
kddikvdqeavkeyaswmdienevvklcptgaikwdgkeltidnrecvrcmhcinkmpka
lkpgde

SCOP Domain Coordinates for d3c7ba1:

Click to download the PDB-style file with coordinates for d3c7ba1.
(The format of our PDB-style files is described here.)

Timeline for d3c7ba1:

  • d3c7ba1 is new in SCOP 1.75
  • d3c7ba1 does not appear in SCOPe 2.01