Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families) |
Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (13 proteins) members of this "family" may be more closely related to other ferredoxins than to each other |
Protein DsrA insert domain [160280] (2 species) |
Species Archaeoglobus fulgidus [TaxId:2234] [160282] (1 PDB entry) Uniprot Q59109 240-305 |
Domain d3c7ba1: 3c7b A:239-304 [156001] Other proteins in same PDB: d3c7ba2, d3c7ba3, d3c7bb1, d3c7bb2, d3c7bb3, d3c7bd2, d3c7bd3, d3c7be1, d3c7be2, d3c7be3 complexed with sf4, so3, srm |
PDB Entry: 3c7b (more details), 2 Å
SCOP Domain Sequences for d3c7ba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c7ba1 d.58.1.5 (A:239-304) DsrA insert domain {Archaeoglobus fulgidus [TaxId: 2234]} kddikvdqeavkeyaswmdienevvklcptgaikwdgkeltidnrecvrcmhcinkmpka lkpgde
Timeline for d3c7ba1: