Lineage for d1f5oc_ (1f5o C:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 530467Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 530468Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 530506Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 531489Protein Lamprey globin [46518] (2 species)
  7. 531503Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [46519] (4 PDB entries)
  8. 531519Domain d1f5oc_: 1f5o C: [15600]

Details for d1f5oc_

PDB Entry: 1f5o (more details), 2.9 Å

PDB Description: 2.9 angstrom crystal structure of deoxygenated lamprey hemoglobin v in the space group p2(1)2(1)2(1)

SCOP Domain Sequences for d1f5oc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f5oc_ a.1.1.2 (C:) Lamprey globin {Sea lamprey (Petromyzon marinus)}
pivdtgsvaplsaaektkirsawapvystyetsgvdilvkfftstpaaqeffpkfkgltt
adqlkksadvrwhaeriinavndavasmddtekmsmklrdlsgkhaksfqvdpqyfkvla
aviadtvaagdagfeklmsmicillrsay

SCOP Domain Coordinates for d1f5oc_:

Click to download the PDB-style file with coordinates for d1f5oc_.
(The format of our PDB-style files is described here.)

Timeline for d1f5oc_: