Lineage for d1f5ob_ (1f5o B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2687786Protein Lamprey globin [46518] (2 species)
  7. 2687800Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [46519] (4 PDB entries)
  8. 2687815Domain d1f5ob_: 1f5o B: [15599]
    complexed with hem

Details for d1f5ob_

PDB Entry: 1f5o (more details), 2.9 Å

PDB Description: 2.9 angstrom crystal structure of deoxygenated lamprey hemoglobin v in the space group p2(1)2(1)2(1)
PDB Compounds: (B:) hemoglobin v

SCOPe Domain Sequences for d1f5ob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f5ob_ a.1.1.2 (B:) Lamprey globin {Sea lamprey (Petromyzon marinus) [TaxId: 7757]}
pivdtgsvaplsaaektkirsawapvystyetsgvdilvkfftstpaaqeffpkfkgltt
adqlkksadvrwhaeriinavndavasmddtekmsmklrdlsgkhaksfqvdpqyfkvla
aviadtvaagdagfeklmsmicillrsay

SCOPe Domain Coordinates for d1f5ob_:

Click to download the PDB-style file with coordinates for d1f5ob_.
(The format of our PDB-style files is described here.)

Timeline for d1f5ob_: