SCOPe 2.02: Domain d3c6ta1: 3c6t A:5-440

Lineage for d3c6ta1 (3c6t A:5-440)

1. Root: SCOPe 2.02

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)

6. Protein HIV-1 reverse transcriptase [56689] (3 species)

7. Species Hiv-1 m:b_hxb2r [TaxId:11706] [190022] (12 PDB entries)

8. Domain d3c6ta1: 3c6t A:5-440 [155989]
   automatically matched to d1c1cb_
   protein/DNA complex; protein/RNA complex; complexed with m14

Details for d3c6ta1

PDB Entry: 3c6t, 2.7 Å

PDB Description: Crystal Structure of HIV Reverse Transcriptase in complex with inhibitor 14

PDB Compounds: (A:) reverse transcriptase

SCOPe Domain Sequences for d3c6ta1:

Sequence; same for both SEQRES and ATOM records:

>d3c6ta1 e.8.1.2 (A:5-440) HIV-1 reverse transcriptase {Hiv-1 m:b_hxb2r [TaxId: 11706]}
ietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfaik
kkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpldedf
rkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqym
ddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwtvqpi
vlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeaelela
enreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtnd
vkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntpplvk
lwyqlekepivgaetf

Timeline for d3c6ta1:

• d3c6ta1 first appeared in SCOP 1.75
  
• d3c6ta1 appears in SCOPe 2.01
  
• d3c6ta1 does not appear in SCOPe 2.03