Lineage for d3c6lh2 (3c6l H:1-120)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2938367Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 2938453Species Mouse (Mus musculus), I-AB [TaxId:10090] [88828] (6 PDB entries)
  8. 2938465Domain d3c6lh2: 3c6l H:1-120 [155988]
    Other proteins in same PDB: d3c6la1, d3c6la2, d3c6lc1, d3c6lc2, d3c6ld1, d3c6le1, d3c6le2, d3c6lg1, d3c6lg2, d3c6lh1
    automatically matched to d1lnub2
    complexed with ca

    fragment; missing more than one-third of the common structure and/or sequence

Details for d3c6lh2

PDB Entry: 3c6l (more details), 3.4 Å

PDB Description: crystal structure of mouse mhc class ii i-ab/3k peptide complexed with mouse tcr 2w20
PDB Compounds: (H:) 3K peptide, Linker,and H-2 class II histocompatibility antigen (A beta chain)

SCOPe Domain Sequences for d3c6lh2:

Sequence, based on SEQRES records: (download)

>d3c6lh2 d.19.1.1 (H:1-120) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-AB [TaxId: 10090]}
feaqkakankavdggggslvprgsggggserhfvyqfmgecyftngtqriryvtryiynr
eeyvrydsdvgehravtelgrpdaeywnsqpeilertraeldtvcrhnyegpethtslrr

Sequence, based on observed residues (ATOM records): (download)

>d3c6lh2 d.19.1.1 (H:1-120) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-AB [TaxId: 10090]}
feaqkakankavrhfvyqfmgecyftngtqriryvtryiynreeyvrydsdvgehravte
lgrpdaeywnsqpeilertraeldtvcrhnyegpethtslrr

SCOPe Domain Coordinates for d3c6lh2:

Click to download the PDB-style file with coordinates for d3c6lh2.
(The format of our PDB-style files is described here.)

Timeline for d3c6lh2: