Lineage for d3c6lh1 (3c6l H:121-217)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 784902Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 784971Species Mouse (Mus musculus), I-A group [TaxId:10090] [88631] (16 PDB entries)
    probably orthologous to the human HLA-DQ group
  8. 784993Domain d3c6lh1: 3c6l H:121-217 [155987]
    Other proteins in same PDB: d3c6la1, d3c6la2, d3c6lc1, d3c6lc2, d3c6ld2, d3c6le1, d3c6le2, d3c6lg1, d3c6lg2, d3c6lh2
    automatically matched to d1lnub1
    complexed with ca

Details for d3c6lh1

PDB Entry: 3c6l (more details), 3.4 Å

PDB Description: crystal structure of mouse mhc class ii i-ab/3k peptide complexed with mouse tcr 2w20
PDB Compounds: (H:) 3K peptide, Linker,and H-2 class II histocompatibility antigen (A beta chain)

SCOP Domain Sequences for d3c6lh1:

Sequence, based on SEQRES records: (download)

>d3c6lh1 b.1.1.2 (H:121-217) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
leqpnvvislsrtealnhhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngdw
tfqvlvmlemtprrgevytchvehpslkspitvewka

Sequence, based on observed residues (ATOM records): (download)

>d3c6lh1 b.1.1.2 (H:121-217) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
leqpnvvislshntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngdwtfqvlvm
lemtprrgevytchvehpslkspitvewka

SCOP Domain Coordinates for d3c6lh1:

Click to download the PDB-style file with coordinates for d3c6lh1.
(The format of our PDB-style files is described here.)

Timeline for d3c6lh1: