Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Class II MHC beta chain, C-terminal domain [88625] (6 species) |
Species Mouse (Mus musculus), I-A group [TaxId:10090] [88631] (16 PDB entries) probably orthologous to the human HLA-DQ group |
Domain d3c6ld1: 3c6l D:121-217 [155981] Other proteins in same PDB: d3c6la1, d3c6la2, d3c6lc1, d3c6lc2, d3c6ld2, d3c6le1, d3c6le2, d3c6lg1, d3c6lg2, d3c6lh2 automatically matched to d1lnub1 complexed with ca |
PDB Entry: 3c6l (more details), 3.4 Å
SCOPe Domain Sequences for d3c6ld1:
Sequence, based on SEQRES records: (download)
>d3c6ld1 b.1.1.2 (D:121-217) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]} leqpnvvislsrtealnhhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngdw tfqvlvmlemtprrgevytchvehpslkspitvewka
>d3c6ld1 b.1.1.2 (D:121-217) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]} leqpnvvislshntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngdwtfqvlvm lemtprrgevytchvehpslkspitvewka
Timeline for d3c6ld1: