SCOPe 2.02: Domain d3c6lc2: 3c6l C:1-82

Lineage for d3c6lc2 (3c6l C:1-82)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)

7. Species Mouse (Mus musculus), I-AU [TaxId:10090] [89859] (17 PDB entries)

8. Domain d3c6lc2: 3c6l C:1-82 [155980]
   Other proteins in same PDB: d3c6la1, d3c6la2, d3c6lc1, d3c6ld1, d3c6ld2, d3c6le1, d3c6le2, d3c6lg1, d3c6lh1, d3c6lh2
   automatically matched to d1k2da2
   complexed with ca

Details for d3c6lc2

PDB Entry: 3c6l, 3.4 Å

PDB Description: crystal structure of mouse mhc class ii i-ab/3k peptide complexed with mouse tcr 2w20

PDB Compounds: (C:) H-2 class II histocompatibility antigen, A-B alpha chain

SCOPe Domain Sequences for d3c6lc2:

Sequence; same for both SEQRES and ATOM records:

>d3c6lc2 d.19.1.1 (C:1-82) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-AU [TaxId: 10090]}
ieadhvgtygisvyqspgdigqytfefdgdelfyvdldkketvwmlpefgqlasfdpqgg
lqniavvkhnlgvltkrsnstp

Timeline for d3c6lc2:

• d3c6lc2 first appeared in SCOP 1.75
  
• d3c6lc2 appears in SCOPe 2.01
  
• d3c6lc2 appears in SCOPe 2.03
  
• d3c6lc2 appears in the current release, SCOPe 2.08