Lineage for d1f5oa_ (1f5o A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 43952Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 43953Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 43963Family a.1.1.2: Globins [46463] (17 proteins)
  6. 44448Protein Lamprey globin [46518] (1 species)
  7. 44449Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [46519] (4 PDB entries)
  8. 44451Domain d1f5oa_: 1f5o A: [15598]

Details for d1f5oa_

PDB Entry: 1f5o (more details), 2.9 Å

PDB Description: 2.9 angstrom crystal structure of deoxygenated lamprey hemoglobin v in the space group p2(1)2(1)2(1)

SCOP Domain Sequences for d1f5oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f5oa_ a.1.1.2 (A:) Lamprey globin {Sea lamprey (Petromyzon marinus)}
pivdtgsvaplsaaektkirsawapvystyetsgvdilvkfftstpaaqeffpkfkgltt
adqlkksadvrwhaeriinavndavasmddtekmsmklrdlsgkhaksfqvdpqyfkvla
aviadtvaagdagfeklmsmicillrsay

SCOP Domain Coordinates for d1f5oa_:

Click to download the PDB-style file with coordinates for d1f5oa_.
(The format of our PDB-style files is described here.)

Timeline for d1f5oa_: