Lineage for d3c6la2 (3c6l A:113-188)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1762507Protein T-cell antigen receptor [49125] (7 species)
  7. 1762598Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [49126] (11 PDB entries)
  8. 1762617Domain d3c6la2: 3c6l A:113-188 [155978]
    Other proteins in same PDB: d3c6la1, d3c6lc1, d3c6lc2, d3c6ld1, d3c6ld2, d3c6le1, d3c6lg1, d3c6lg2, d3c6lh1, d3c6lh2
    automatically matched to d1lp9e2
    complexed with ca

Details for d3c6la2

PDB Entry: 3c6l (more details), 3.4 Å

PDB Description: crystal structure of mouse mhc class ii i-ab/3k peptide complexed with mouse tcr 2w20
PDB Compounds: (A:) TCR 2W20 alpha chain

SCOPe Domain Sequences for d3c6la2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c6la2 b.1.1.2 (A:113-188) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]}
iqnpepavyqlkdprsqdstlclftdfdsqinvpktmesgtfitdktvldmkamdsksng
aiawsnqtsftcqdif

SCOPe Domain Coordinates for d3c6la2:

Click to download the PDB-style file with coordinates for d3c6la2.
(The format of our PDB-style files is described here.)

Timeline for d3c6la2: