Lineage for d3c6la1 (3c6l A:7-109)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1289510Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 1289604Species Mouse (Mus musculus) [TaxId:10090] [88541] (34 PDB entries)
  8. 1289649Domain d3c6la1: 3c6l A:7-109 [155977]
    Other proteins in same PDB: d3c6la2, d3c6lc1, d3c6lc2, d3c6ld1, d3c6ld2, d3c6le2, d3c6lg1, d3c6lg2, d3c6lh1, d3c6lh2
    automatically matched to d1lila1
    complexed with ca

Details for d3c6la1

PDB Entry: 3c6l (more details), 3.4 Å

PDB Description: crystal structure of mouse mhc class ii i-ab/3k peptide complexed with mouse tcr 2w20
PDB Compounds: (A:) TCR 2W20 alpha chain

SCOPe Domain Sequences for d3c6la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c6la1 b.1.1.1 (A:7-109) Immunoglobulin light chain lambda variable domain, VL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
pqsltvwegetailncsyedstfdyfpwyhqfpgespalliairpvsnkkedgrftiffn
krekkfslhiadsqpgdsatyfcaasdnriffgdgtqlvv

SCOPe Domain Coordinates for d3c6la1:

Click to download the PDB-style file with coordinates for d3c6la1.
(The format of our PDB-style files is described here.)

Timeline for d3c6la1: