SCOP 1.67: Domain d2lhb__: 2lhb -

Lineage for d2lhb__ (2lhb -)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (20 proteins)
   Heme-binding protein

6. Protein Lamprey globin [46518] (2 species)

7. Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [46519] (4 PDB entries)

8. Domain d2lhb__: 2lhb - [15597]
   complexed with hem

Details for d2lhb__

PDB Entry: 2lhb, 2 Å

PDB Description: refinement of a molecular model for lamprey hemoglobin from petromyzon marinus

SCOP Domain Sequences for d2lhb__:

Sequence; same for both SEQRES and ATOM records:

>d2lhb__ a.1.1.2 (-) Lamprey globin {Sea lamprey (Petromyzon marinus)}
pivdtgsvaplsaaektkirsawapvystyetsgvdilvkfftstpaaqeffpkfkgltt
adelkksadvrwhaeriinavddavasmddtekmsmklrnlsgkhaksfqvdpeyfkvla
aviadtvaagdagfeklmsmicillrsay

Timeline for d2lhb__:

• d2lhb__ first appeared (with stable ids) in SCOP 1.55
  
• d2lhb__ appears in SCOP 1.65
  
• d2lhb__ appears in SCOP 1.69
  
• d2lhb__ appears in the current release, SCOPe 2.08, called d2lhba_