SCOPe 2.08: Domain d2lhba_: 2lhb A:

Lineage for d2lhba_ (2lhb A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Lamprey globin [46518] (2 species)

7. Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [46519] (4 PDB entries)

8. Domain d2lhba_: 2lhb A: [15597]
   complexed with cyn, hem

Details for d2lhba_

PDB Entry: 2lhb, 2 Å

PDB Description: refinement of a molecular model for lamprey hemoglobin from petromyzon marinus

PDB Compounds: (A:) hemoglobin v (cyano met)

SCOPe Domain Sequences for d2lhba_:

Sequence; same for both SEQRES and ATOM records:

>d2lhba_ a.1.1.2 (A:) Lamprey globin {Sea lamprey (Petromyzon marinus) [TaxId: 7757]}
pivdtgsvaplsaaektkirsawapvystyetsgvdilvkfftstpaaqeffpkfkgltt
adelkksadvrwhaeriinavddavasmddtekmsmklrnlsgkhaksfqvdpeyfkvla
aviadtvaagdagfeklmsmicillrsay

Timeline for d2lhba_:

• d2lhba_ first appeared (with stable ids) in SCOP 1.55, called d2lhb__
  
• d2lhba_ appears in SCOPe 2.07