Lineage for d3c60g1 (3c60 G:83-182)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2747348Protein Class II MHC alpha chain, C-terminal domain [88618] (7 species)
  7. 2747416Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (32 PDB entries)
    probably orthologous to the human HLA-DQ group
  8. 2747456Domain d3c60g1: 3c60 G:83-182 [155965]
    Other proteins in same PDB: d3c60a1, d3c60a2, d3c60b1, d3c60b2, d3c60c2, d3c60d1, d3c60d2, d3c60e1, d3c60e2, d3c60f1, d3c60f2, d3c60g2, d3c60h1, d3c60h2
    automated match to d1k2da1

Details for d3c60g1

PDB Entry: 3c60 (more details), 3.05 Å

PDB Description: crystal structure of mouse mhc class ii i-ab/3k peptide complexed with mouse tcr yae62
PDB Compounds: (G:) H-2 class II histocompatibility antigen, A-B alpha chain

SCOPe Domain Sequences for d3c60g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c60g1 b.1.1.2 (G:83-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
atneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvadgvyetsffvnr
dysfhklsyltfipsdddiydckvehwgleepvlkhwepe

SCOPe Domain Coordinates for d3c60g1:

Click to download the PDB-style file with coordinates for d3c60g1.
(The format of our PDB-style files is described here.)

Timeline for d3c60g1: